PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025870P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 316aa    MW: 35122.4 Da    PI: 9.9121
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025870P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.65e-072974346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     rWT  E + + +a + + ++   +W ++a++++ g+t  +++  + +
   MELO3C025870P1 29 RWTVAENKMFENALAIFDTDtpdRWQKVASMIP-GKTVGDVIRQYKD 74
                     9********************************.*****99998876 PP

2Myb_DNA-binding48.12.7e-15135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
   MELO3C025870P1 135 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 179
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.2222580IPR017884SANT domain
SMARTSM007176.5E-82678IPR001005SANT/Myb domain
SuperFamilySSF466894.44E-102882IPR009057Homeodomain-like
CDDcd001673.23E-62975No hitNo description
PfamPF002491.5E-52975IPR001005SANT/Myb domain
PROSITE profilePS5129420.955128184IPR017930Myb domain
SuperFamilySSF466895.68E-17130183IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-18131183IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.4E-13132179IPR009057Homeodomain-like
SMARTSM007172.7E-13132182IPR001005SANT/Myb domain
CDDcd001671.54E-11135180No hitNo description
PfamPF002495.7E-13135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MKWEMEILSS PSSLVSSMSW SSGDGKASRW TVAENKMFEN ALAIFDTDTP DRWQKVASMI  60
PGKTVGDVIR QYKDLEADVS SIEAGLIPIP GYDTSQFTLD WVNSHSYDGF KQSYGLIGKR  120
SSGRSADQER KKGVPWTEEE HKLFLMGLKK YGKGDWRNIS RNFVVTRTPT QVASHAQKYF  180
IRQLSGGKDK RRASIHDITT VNLNDTRSPS PENKKSVSPE HATVLPRHSN PSSTVPRAAF  240
NWNQQQQHNT PGAAMVFNHS NGNIFMSPGA FGVNSYAAGL RLPEHHLQKG SVNEPFIGPQ  300
NMIFQMQAGH CFPHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-152195276RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819190.0LN681919.1 Cucumis melo genomic scaffold, anchoredscaffold00084.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464055.10.0PREDICTED: transcription factor DIVARICATA isoform X1
SwissprotQ8S9H71e-128DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KC640.0A0A0A0KC64_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g06100.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-102Homeodomain-like transcriptional regulator